MCT1 (Malignant T Cell-amplified Sequence 1, MCT-1, Multiple Copies T-cell Malignancies 1, MCTS1)

Size

£698.00

SKU:: 129510
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-182 from human MCTS1 (AAH01013) with GST tag.
Clone:: 1G1-2A2
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: MCT-1 is a novel gene encoding malignant T cell amplified sequence 1 that was identified from T-cell leukemia/lymphoma cell lines with limited homology to a region of Cyclin H. MCT-1 is a novel candidate oncogene that results in a shortened G1 phase and increased rate of proliferation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.