129489-FITC
MCFD2 (Neural Stem Cell-derived Neuronal Survival Protein, Multiple Coagulation Factor Deficiency Protein 2, SDNSF, DKFZp686G21263, F5F8D, F5F8D2, LMAN1IP) (FITC)
Size
£914.00
- SKU:
- 129489-FITC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-147 from human MCFD2 (AAH40357) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3A5-G4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- Multiple coagulation factor deficiency 2 (MCFD2), also known as SDNSF. This is expressed by neural stem/progenitor cells of the hippocampus, and localized to region where neurogenesis persists throughout life. It has been found to prevent NSC cell death and to maintain stem cell characteristics. This protein forms a complex with LAMN1 that facilitates the transport of coagulation factors V and VIII from the endoplasmic reticulum to the Golgi apparatus via an endoplasmic reticulum Golgi intermediate compartment. Mutations in the MCFD2 gene may cause Factor V and Factor VIII combined deficiency. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice