MCCC2 (MCCB, Methylcrotonoyl-CoA Carboxylase beta Chain, Mitochondrial, 3-methylcrotonyl-CoA Carboxylase 2, 3-methylcrotonyl-CoA Carboxylase Non-biotin-containing Subunit, 3-methylcrotonyl-CoA:carbon Dioxide Ligase Subunit beta)

Size

£685.00

SKU:: 129485
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa456-564 from human MCCC2 (NP_071415) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: This gene encodes the small subunit of 3-methylcrotonyl-CoA carboxylase. This enzyme functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Mutations in this gene are associated with 3-Methylcrotonylglycinuria, an autosomal recessive disorder of leucine catabolism. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AYSPRFLYIWPNARISVMGGEQAANVLATITKDQRAREGKQFSSADEAALKEPIIKKFEEEGNPYYSSARVWDDGIIDPADTRLVLGLSFSAALNAPIEKTDFGIFRM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.