MBD1 (Methyl-CpG-binding Domain 1, PCM1, Methyl-CpG-binding Protein MBD1, Protein Containing Methyl-CpG-binding Domain 1, CXXC-type Zinc Finger Protein 3, CXXC3, PCM1)

Size

£685.00

SKU:: 129463
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa415-508 from human MBD1 (NP_056671) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The MBD family of proteins includes MeCP2, MBD1, MBD2, MBD3 and MBD4. MBD1 (methyl-CpG binding domain protein 1) binds to methylated CpG sites and represses gene transcription. MBD1 is recruited to both methylated and non-methylated CpGs by separate domains: the CXXC domain targets the protein to non-methylated CpGs whereas the MBD domain targets the protein to methylated CpG. MBD1 may also interact with histone methyltransferase SETDB1 to repress transcription. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: HHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.