MARCH9 (E3 Ubiquitin-protein Ligase MARCH9, Membrane-associated RING Finger Protein 9, Membrane-associated RING-CH Protein IX, MARCH-IX, RING Finger Protein 179, RNF179, FLJ36578, MARCH-IX)

Size

£685.00

SKU:: 129433
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa240-345 from human MARCH9 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: MARCH9 belongs to the membrane associated RING-CH (MARCH) family of genes which encode a novel group of RING-type ubiquitin E3 ligases. It is the first ubiquitin E3 ligase to control expression of the critical cell adhesion molecule ICAM-1. The expression of the protein causes ubiquitination and downregulation of ICAM-1. A short alternative transcript of MARCH9 lacking the RING-CH domain, termed MARCH9 RINGless, is shown to act as a positive regulator of MARCH9 activity. Overexpression of the protein, leads to downregulation of cell surface major histocompatibility complex (MHC) class I and CD4. Human MARCH9 gene maps to chromosome 12q14.1. Applications: Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: HEGSSVYRIFKRWQAVNQQWKVLNYDKTKDIGGDAGGGTAGKSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice