129433-BIOTIN

MARCH9 (E3 Ubiquitin-protein Ligase MARCH9, Membrane-associated RING Finger Protein 9, Membrane-associated RING-CH Protein IX, MARCH-IX, RING Finger Protein 179, RNF179, FLJ36578, MARCH-IX) (Biotin)

Size

£914.00

SKU:: 129433-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa240-346 from human MARCH9 (NP_612405) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B5
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: MARCH9 belongs to the membrane associated RING-CH (MARCH) family of genes which encode a novel group of RING-type ubiquitin E3 ligases. It is the first ubiquitin E3 ligase to control expression of the critical cell adhesion molecule ICAM-1. The expression of the protein causes ubiquitination and downregulation of ICAM-1. A short alternative transcript of MARCH9 lacking the RING-CH domain, termed MARCH9 RINGless, is shown to act as a positive regulator of MARCH9 activity. Overexpression of the protein, leads to downregulation of cell surface major histocompatibility complex (MHC) class I and CD4. Human MARCH9 gene maps to chromosome 12q14.1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HEGSSVYRIFKRWQAVNQQWKVLNYDKTKDIGGDAGGGTAGKSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTT Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice