129420-BIOTIN
MAPKSP1 (LAMTOR3, MAP2K1IP1, MAPKSP1, Ragulator Complex Protein LAMTOR3, Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 3, MEK-binding Partner 1, Mp1, Mitogen-activated Protein Kinase Kinase 1-interacting Protein 1, Mitogen-activated Protein Kinase Scaffold Protein 1, PRO2783) (Biotin)
Size
£914.00
- SKU:
- 129420-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-88 from MAPKSP1 (NP_068805) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2A4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- MAPKSP1 (Mitogen-activated protein kinase scaffold protein 1) is a scaffold protein that functions in the extracellular signal-regulated kinase (ERK) cascade. The protein is localized to late endosomes by the mitogen-activated protein-binding protein-interacting protein, and binds specifically to MAP kinase kinase MAP2K1/MEK1, MAP kinase MAPK3/ERK1, and MAP kinase MAPK1/ERK2. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLP* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice