129404-FITC

MAPK3 (Mitogen-activated Protein Kinase 3, MAPK 3, MAP Kinase 3, ERT2, Extracellular Signal-regulated Kinase 1, ERK1, ERK-1, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p44, Microtubule-associated Protein 2 Kinase, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, P44ERK1, p44-ERK1, P44MAPK, p44-MAPK, PRKM3, MGC20180) (FITC)

Size

£914.00

SKU:: 129404-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa279-379, from human MAPK3, (AAH13992) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3C9
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: One of the major signaling pathways used by eukaryotic cells to translate extracellular signals into cellular responses is the MAP (mitogen-activated protein) kinase cascade. So far, four MAPK subgroups (ERK, ERK5, JNK and p38) have been identified in humans. ERK, extracellular signal-regulated kinases 1 and 2 are growth factor-sensitive serine/threonine kinases. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 25ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice