129389-APC
MAP4K4 (Mitogen-activated Protein Kinase Kinase Kinase Kinase 4, HPK/GCK-like Kinase HGK, HGK, KIAA0687, MAPK/ERK Kinase Kinase Kinase 4, MEK Kinase Kinase 4, MEKKK 4, MEKKK4, Nck-interacting Kinase, NIK) (APC)
Size
£927.00
- SKU:
- 129389-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa611-710 from MAP4K4 (NP_663719) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4A5
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- MAP4K4 is a MSN protein kinase. The protein has a structure similar to other GCK (Group I) kinases and contains two consensus SH3 binding motifs, which have been shown to interact with the SH3 domains of the SH2/SH3 adapter protein Nck. NIK can be activated by tumor necrosis factor (TNF)-alpha. Activated NIK has been shown to activate c-Jun N-terminal kinase (JNK) and to bind and activate the plasma membrane Na-H exchanger NHE1. In NIK(-/-) mice, mesodermal and endodermal cells of the primitive streak fail to migrate to their correct location, and embryos die between embryonic day (E) 9.5 and E10.5. At least three protein isoforms have been reported. Applications: Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: VHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPV Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice