MAP2K3 (Dual Specificity Mitogen-activated Protein Kinase Kinase 3, Mitogen-activated Protein Kinase Kinase 3, MAP Kinase Kinase 3, MAPKK 3, MKK3, MAPK/ERK Kinase 3, MEK 3, MEK3, PRKMK3, Stress-activated Protein Kinase Kinase 2, SAPK Kinase 2, SAPKK2, SAPKK-2, SKK2)

Size

£685.00

SKU:: 129371
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-100, from human MAP2K3 (AAH32478) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2F12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: MKK3 is a protein kinase that phosphorylates the p38 MAPK. Phosphorylation by MKK3 occurs on threonine and tyrosine residues and increases the activity of p38 to stimulate transcription factors ATF2 and Elk-1. MKK3, together with MKK6, serves as upstream regulators of p38 MAPK activation. A structural variant, MKK3b, has been identified that contains 29 more aa at its N-terminus. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.