129365-BIOTIN
MAP2K1 (Mitogen-activated Protein Kinase Kinase 1, MAP Kinase Kinase 1, MAPK/ERK Kinase 1, MEK1, MAPKK 1, MAPKK1, MEK 1, MKK1, Dual Specificity Mitogen-activated Protein Kinase Kinase 1, ERK Activator Kinase 1, PRKMK1) (Biotin)
Size
£914.00
- SKU:
- 129365-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa294-393, from human MAP2K1 (NP_002746) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1B5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- MEK1 is an integral component of the MAP kinase cascade that regulates cell growth and differentiation and this pathway also plays a key role in synaptic plasticity in brain. Activated MEK1 acts as a dual specificity kinase phosphorylating both a threonine and a tyrosine residue on MAP kinase. Conversely there also appears to be a feedback phosphorylation of MEK1 by MAP kinase. The sites on MEK1 that are phosphorylated by MAP kinase are Thr292 and Thr386. human MEK1 gene is localized on chromosomal region 15q22.1-q22.33. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice