129361-BIOTIN
MAP1LC3B (Microtubule-associated Proteins 1A/1B Light Chain 3B, Autophagy-related Protein LC3 B, Autophagy-related Ubiquitin-like Modifier LC3 B, MAP1 Light Chain 3-like Protein 2, MAP1A/MAP1B Light Chain 3 B, MAP1A/MAP1B LC3 B, Microtubule-associated Protein 1 Light Chain 3 beta, MAP1ALC3) (Biotin)
Size
£914.00
- SKU:
- 129361-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa1-71 from human MAP1LC3B with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4E11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Microtubule-associated protein 1 light chain 3 (LC3) is a fibronectin mRNA-binding protein linked to mRNA translation. Three human isoforms of MAP1-LC3 have been cloned and characterized (MAP1- LC3A, -B, -C). These isoforms differ in their post-translation modification. MAP-LC3 proteins are related to cell growth, differentiation and migration in development and in diseases. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice