MAP1LC3A (Microtubule-associated Proteins 1A/1B Light Chain 3A, Autophagy-related Protein LC3 A, Autophagy-related Ubiquitin-like Modifier LC3 A, MAP1 Light Chain 3-like Protein 1, MAP1A/MAP1B Light Chain 3 A, MAP1A/MAP1B LC3 A, Microtubule-associated Protein 1 Light Chain 3 alpha, ATG8E)

Size

£685.00

SKU:: 129360
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-103 from human MAP1LC3A (NP_115903) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Involved in formation of autophagosomal vacuoles (autophagosomes). Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.