129360-BIOTIN

MAP1LC3A (Microtubule-associated Proteins 1A/1B Light Chain 3A, Autophagy-related Protein LC3 A, Autophagy-related Ubiquitin-like Modifier LC3 A, MAP1 Light Chain 3-like Protein 1, MAP1A/MAP1B Light Chain 3 A, MAP1A/MAP1B LC3 A, Microtubule-associated Protein 1 Light Chain 3 alpha, ATG8E) (Biotin)

Size

£914.00

SKU:: 129360-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-103 from human MAP1LC3A (NP_115903) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D5
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Involved in formation of autophagosomal vacuoles (autophagosomes). Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.