MAN2C1 (MANA, MANA1, Alpha-mannosidase 2C1, Alpha Mannosidase 6A8B, Alpha-D-mannoside Mannohydrolase, Mannosidase alpha Class 2C Member 1, DKFZp686E23167, MGC87979)

Size

£698.00

SKU:: 129347
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa258-367 from human MAN2C1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1G12
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: MAN2C1 belongs to the glycosyl hydrolase 38 family. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HCHIDTAWLWPFKETVRKCARSWVTALQLMERNPEFIFACSQAQQLEWVKSRYPGLYSRIQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQFLQGQNFFLQEFGKMCSE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.