MAN1B1 (Endoplasmic Reticulum Mannosyl-oligosaccharide 1,2-alpha-mannosidase, ER alpha-1,2-Mannosidase, ER Mannosidase 1, ERMan1, Man9GlcNAc2-specific-processing alpha-mannosidase, Mannosidase alpha Class 1B Member 1, UNQ747/PRO1477)

Size

£685.00

SKU:: 129341
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa112-212 from MAN1B1 (NP_057303) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6B1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Involved in glycoprotein quality control targeting of misfolded glycoproteins for degradation. It primarily trims a single alpha-1,2-linked mannose residue from Man9GlcNAc2 to produce Man8GlcNAc2, but at high enzyme concentrations, as found in the ER quality control compartment (ERQC), it further trims the carbohydrates to Man5-6GlcNAc2. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AFRLEEEQKMRPEIAGLKPANPPVLPAPQKADTDPENLPEISSQKTQRHIQRGPPHLQIRPPSQDLKDGTQEEATKRQEAPVDPRPEGDPQRTVISWRGA* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.