129297-BIOTIN
MAFA (Transcription Factor MafA, Pancreatic beta-cell-specific Transcriptional Activator, Transcription Factor RIPE3b1, V-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog A) (Biotin)
Size
£914.00
- SKU:
- 129297-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa222-308 of human MAFA with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2F1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- MafA is a 352aa containing transcription factor playing an important part in the regulation of the insulin gene transcription. It belongs to the bZIP family and Maf subfamily with a bZIP domain and binds DNA as a homodimer. Transcription factor MafA binds to RIPE3b, a conserved enhancer element that regulates pancreatic beta cell-specific expression of the insulin gene. MafA is known to cooperate synergistically with NEUROD1 and PDX1 and is known to be up-regulated by glucose. It is detected in nuclei of pancreas islet beta cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: LEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice