LZIC (Protein LZIC, Leucine Zipper and CTNNBIP1 Domain-containing Protein, Leucine Zipper and ICAT Homologous Domain-containing Protein, MGC15436)

Size

£685.00

SKU:: 129278
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human LZIC, aa1-190 (NP_115744).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: LZIC belongs to the CTNNBIP1 family. It is ubiquitously expressed with highest levels in kidney. LZIC is up-regulated in several cases of gastric cancers. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.