129261-FITC
Lymphocyte Antigen 75 (LY75, Ly-75, C-type Lectin Domain Family 13 Member B, DEC-205, gp200-MR6, CD205, CLEC13B) (FITC)
Size
£914.00
- SKU:
- 129261-FITC
- Application:
- FLISA
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa37-135 from human LY75 (NP_002340) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3G4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- CD205 is a 210kD C-type lectin transmembrane protein, known as DEC-205. It belongs to macrophage mannose receptor family and is found at high levels on dendritic cells and thymic epithelial cells. Unlike murine CD205, human CD205 is also expressed at low levels on T- and B-cells, NK cells and monocytes. CD205, serves as an endocytic receptor, functions in antigen uptake/processing and clearance of apoptotic cells. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TIVHGNTGKCIKPVYGWIVADDCDETEDKLWKWVSQHRLFHLHSQKCLGLDITKSVNELRMFSCDSSAMLWWKCEHHSLYGAARYRLALKDGHGTAIS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice