LSS (Lanosterol Synthase, 2,3-epoxysqualene--lanosterol Cyclase, Oxidosqualene--lanosterol Cyclase, OSC, hOSC, FLJ25486, FLJ35015, FLJ39450, FLJ46393)

Size

£685.00

SKU:: 129243
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa633-732 from human LSS with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E4
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Catalyzes the cyclization of (S)-2,3 oxidosqualene to lanosterol, a reaction that forms the sterol nucleus. Applications: Suitable for use in Immunofluorescence, ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunohistochemistry (FFPE): 3ug/ml Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: FESCEERRYLQSAQSQIHNTCWAMMGLMAVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGRFSQLYPERALAGHP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.