LSD1 (Lysine-specific Histone Demethylase 1A, BRAF35-HDAC Complex Protein BHC110, Flavin-containing Amine Oxidase Domain-containing Protein 2, KDM1A, AOF2, KDM1, KIAA0601)

Size

£685.00

SKU:: 129235
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa753-852 from AOF2 (NP_055828) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: LSD1, a novel and first known lysine-specific histone demethylase, nuclear protein belonging to the flavin monoamine oxidase family with a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. LSD1, a component of several histone deacetylase complexes, is ubiquitously expressed in most of the tissues. A component of the CoREST and other transcriptional co-repressor complexes, LSD1 is known to play an important role in silencing neuronal-specific genes in non-neuronal cells. It is also known to demethylate Lys-4 of histone H3, a specific tag for epigenetic transcriptional activation. Reports suggest that it plays an important role in stimulating androgen-receptor-dependent transcription converting oxygen to hydrogen peroxide (possibly using alternative electron acceptors). Along with nuclear FHL2 it serves as a novel biomarker predictive for prostate cancer. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPS* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice