129235-ML490
LSD1 (Lysine-specific Histone Demethylase 1A, BRAF35-HDAC Complex Protein BHC110, Flavin-containing Amine Oxidase Domain-containing Protein 2, KDM1A, AOF2, KDM1, KIAA0601) (MaxLight 490)
Size
£914.00
- SKU:
- 129235-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa753-852 from AOF2 (NP_055828) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2E7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. LSD1, a novel and first known lysine-specific histone demethylase, nuclear protein belonging to the flavin monoamine oxidase family with a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. LSD1, a component of several histone deacetylase complexes, is ubiquitously expressed in most of the tissues. A component of the CoREST and other transcriptional co-repressor complexes, LSD1 is known to play an important role in silencing neuronal-specific genes in non-neuronal cells. It is also known to demethylate Lys-4 of histone H3, a specific tag for epigenetic transcriptional activation. Reports suggest that it plays an important role in stimulating androgen-receptor-dependent transcription converting oxygen to hydrogen peroxide (possibly using alternative electron acceptors). Along with nuclear FHL2 it serves as a novel biomarker predictive for prostate cancer. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQATPGVPAQQSPS* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice