129227-APC
LRRK2 (Leucine-rich Repeat Kinase 2, Leucine-rich Repeat Serine/threonine Protein Kinase 2, AURA17, Dardarin, PARK8, RIPK7, ROCO2) (APC)
Size
£927.00
- SKU:
- 129227-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa2161-2260 from human LRRK2 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3B2
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- Parkinson is the second most common neurodegenerative disease after Alzheimers. About 1 percent of people over the age of 65 and 3 percent of people over the age of 75 are affected by the disease. The mutation is the most common cause of Parkinson's disease identified to date. LRRK2, a genetic mutation, was recently found linked to about 5 percent of inherited cases of Parkinson's disease. By high-resolution recombination mapping and candidate gene sequencing in 46 families, 6 disease-segregating mutations (5 missense and 1 putative splice site mutation). It may be central to the pathogenesis of several major neurodegenerative disorders associated with parkinsonism. LRRK2 belongs to the ROCO protein family and includes a protein kinase domain of the MAPKKK class and several other major functional domains. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice