LRRFIP1 (Leucine-rich Repeat Flightless-interacting Protein 1, LRR FLII-interacting Protein 1, GC-binding Factor 2, TAR RNA-interacting Protein, GCF2, TRIP) (MaxLight 490)

Size

£934.00

SKU:: 129220-ML490
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human LRRFIP1, aa1-105 (AAH10662.1)
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Extra Details:: MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Leucine-rich repeat FLI-I interacting protein 1 (LRRFIP1/FLAP-1) is a MyD88-interacting signal protein which mediates either induction or repression of TLR signaling. Flap-1 directly interacts with beta-catenin and activates beta-catenin-dependent transcription activity. Flap-1 or LRRFIP1 was also shown to bind the TNF- -308 promoter polymorphism site, suggesting its possible role in the regulation of TNF- production. FLAP-1 along with LRRFIP2 and FLIIH serve as a balance in coordinating inflammatory response after infection, and may act as a novel target in the control of agonist-induced TLR-mediated inflammatory and autoimmune diseases. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice