129202-BIOTIN

LRIT3 (Leucine-rich Repeat, Immunoglobulin-like Domain and Transmembrane Domain-containing Protein 3, FIGLER4, FLJ44691, MGC120618) (Biotin)

Size

£914.00

SKU:: 129202-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa422-497 from human LRIT3 (NP_940908) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E7
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Might facilitate FGFR1 exit from the endoplasmic reticulum to the Golgi. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody. Immunohistochemistry (Formalin fixed paraffin embedded): 1.2ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: KVCKLQCKSEPFWEDDLAKETYIQFETLFPRSQSVGELWTRSHRDDSEKLLLCSRSSVESQVTFKSEGSRPEYYC* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.