LNX1 (E3 Ubiquitin-protein Ligase LNX, Ligand of Numb-protein X 1, Numb-binding Protein 1, PDZ Domain-containing RING Finger Protein 2, LNX, PDZRN2, UNQ574/PRO1136)

Size

£685.00

SKU:: 129151
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa19-119 from human LNX1 (NP_116011) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4E3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of NUMB. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates ubiquitination of isoform p66 and isoform p72 of NUMB, but not that of isoform p71 or isoform p65. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DNVGNLHFLYSELCKGAFHYGLTKDRKRRSQDGCPDGCASLTATAPSPEVSAAATISLMTDEPGLDNPAYVSSAEDGQPAISPVDSGRSNRTRARPFERS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.