LMBR1 (Limb Region 1 Protein Homolog, Differentiation-related Gene 14 Protein, C7orf2, DIF14, ACHP, FLJ11665, PPD2, TPT)

Size

£685.00

SKU:: 129132
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa214-296 from human LMBR1 (NP_071903) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4A1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Probable lysosomal cobalamin transporter. Required to export cobalamin from lysosomes allowing its conversion to cofactors. Isoform 3 may play a role in the assembly of hepatitis delta virus (HDV). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SRMFTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERNLVYP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.