LIVIN (Baculoviral IAP Repeat-containing Protein 7, Kidney Inhibitor of Apoptosis Protein, KIAP, ML-IAP, RING Finger Protein 50, Melanoma Inhibitor of Apoptosis Protein, BIRC7, KIAP, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344)

Size

£685.00

SKU:: 129126
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-91 from human BIRC7 (NP_647478) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3H1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Livin is a member of IAP family characterized by the presence of an N-terminal, conserved, single BIR domain and a C-terminal RING-type zinc finger domain. It plays a vital role in caspase regulation, anti-apoptosis and tumorigenesis. Livin interacts with diverse pro-apoptotic factors and inhibits apoptosis triggered by various death stimuli in a caspase-dependent and caspase-independent methods. BIR domain of Livin binds to caspase-9, inhibits its proteolysis and induces a caspase-dependent anti-apoptotic cascade. Alternatively, Livin has also been found to activate MAP kinase and inhibit apoptosis via TAK1/JNK1 signaling cascade. Northern Blot analysis detected an elevated expression in developmental tissues and human melanomas, suggesting a potential cancer target. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice