129126-ML490
LIVIN (Baculoviral IAP Repeat-containing Protein 7, Kidney Inhibitor of Apoptosis Protein, KIAP, ML-IAP, RING Finger Protein 50, Melanoma Inhibitor of Apoptosis Protein, BIRC7, KIAP, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344) (MaxLight 490)
Size
£914.00
- SKU:
- 129126-ML490
- Application:
- FLISA
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-91 from human BIRC7 (NP_647478) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3H1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Livin is a member of IAP family characterized by the presence of an N-terminal, conserved, single BIR domain and a C-terminal RING-type zinc finger domain. It plays a vital role in caspase regulation, anti-apoptosis and tumorigenesis. Livin interacts with diverse pro-apoptotic factors and inhibits apoptosis triggered by various death stimuli in a caspase-dependent and caspase-independent methods. BIR domain of Livin binds to caspase-9, inhibits its proteolysis and induces a caspase-dependent anti-apoptotic cascade. Alternatively, Livin has also been found to activate MAP kinase and inhibit apoptosis via TAK1/JNK1 signaling cascade. Northern Blot analysis detected an elevated expression in developmental tissues and human melanomas, suggesting a potential cancer target. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELR Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice