LHX1 (LIM/Homeobox Protein Lhx1, LIM Homeobox Protein 1, Homeobox Protein Lim-1, hLim-1, LIM-1, LIM1, MGC126723, MGC138141)

Size

£685.00

SKU:: 129078
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-100 from LHX1 (NP_005559) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4D1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Potential transcription factor. May play a role in early mesoderm formation and later in lateral mesoderm differentiation and neurogenesis. Applications: Suitable for use in Immunofluorescence, ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 0.8ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLST Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.