LGR7 (Relaxin Receptor 1, Leucine-rich Repeat-containing G-protein Coupled Receptor 7, Relaxin Family Peptide Receptor 1, RXFP1, LGR7.1, LGR7.10, LGR7.2, MGC138347, MGC142177)

Size

£685.00

SKU:: 129077
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa68-163 from human LGR7 (NP_067647) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: LGR7 is a member of the Relaxin Receptor subfamily. LGR7 has been reported in adrenal, brain, colon, heart, kidney, liver, lung, ovary, placenta, prostate, salivary gland, small intestine, testis, and uterus. ESTs have been isolated from melanocyte/uterus/fetal heart and skeletal muscle libraries. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: WSMQFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLCQGLELDCDETNLRAVPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQNNKI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.