LETM1 and EF-hand Domain Containing Protein 1, Mitochondrial (LETM1, Leucine Zipper-EF-hand-containing Transmembrane Protein 1)

Size

£685.00

SKU:: 129063
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa601-708 from human LETM1 (NP_036450) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6F7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: LETM1 (Leucine zipper-EF-hand containing transmembrane protein 1) contains 2 EF-hand calcium-binding sites, a transmembrane domain, a leucine zipper motif and several coiled-coil domains. Crucial for the maintenance of mitochondrial tubular networks and for the assembly of the supercomplexes of the respiratory chain. Required for the maintenance of the tubular shape and cristae organization. There are three isoforms. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice