Latrophilin 1 (Latrophilin-1, LPHN1, Calcium-independent alpha-latrotoxin Receptor 1, CIRL1, CIRL-1, CL1, KIAA0821, Lectomedin-2, LEC2)

Size

£685.00

SKU:: 129018
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-202 from LPHN1 (AAH19928) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4E12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Latrophilin-1 is a brain-specific Orphan-B Receptor that binds alpha-latrotoxin, a potent presynaptic neurotoxin present in the venom of the black widow spider, in a Ca2+-independent manner. As with the other two latrophilins, it shares homology with lectin, olfactomedin, and transmembrane domains, and possesses variable C-termini and various alternative-splicing sites. CIRL is endogenously cleaved into two pieces at the GPCR proteolytic site (GPS) located adjacent to the first transmembrane helix as a mechanism to compartmentalize the cell adhesion and GPCR activation functions. Latrophilin-1 has been reported to be expressed predominantly in the brain. Very weak expression has also been documented in human heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas. ESTs have been isolated from brain, eye, kidney, lung, and lymph node libraries. In addition, ESTs have been isolated from the following cancer libraries: brain, choriocarcinoma, epithelioid carcinoma, kidney, and lung. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGLASHLERLMAEGKWGGTGVVEGMGMAEEGAGNGKAVWGMGRGKGERSPSLSSTFPQGRRSQVPGLGSGHPCSGRLDPKSQTPEAPGSGCVLSTCPGPLLSSLSGQPPQPPSLNSRGSIAPGHPSPAPALPFPQRWPLHLCSDLSPSLCPSFSHKCHEFSNIFGSQPAAAMNFVGLRGRGSRKELGGRGQVGGWRDPFCC* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice