LAT (Linker for Activation of T-cells Family Member 1, 36kD Phospho-tyrosine Adapter Protein, pp36, p36-38)

Size

£685.00

SKU:: 129015
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-234 from human LAT (AAH11563) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B11-1D5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: LAT is a transmembrane molecule that mediates signaling following the engagement of a number of cell surface receptors including TCR during mature T cell activation, pre-TCR during T cell development, Fc RIII on NK cells, and FceRI on mast cells. LAT is multiply phosphorylated on tyrosines by ZAP-70 and Syk, which leads to downstream effects that include release of intracellular calcium, PKC activation, MAPK activation and cytoskeletal reorganization. Palmitoylation of LAT is required for its localization to lipid rafts and efficient phosphorylation. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGPHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice