129015-ML490
LAT (Linker for Activation of T-cells Family Member 1, 36kD Phospho-tyrosine Adapter Protein, pp36, p36-38) (MaxLight 490)
Size
£914.00
- SKU:
- 129015-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-234 from human LAT (AAH11563) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3B11-1D5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. LAT is a transmembrane molecule that mediates signaling following the engagement of a number of cell surface receptors including TCR during mature T cell activation, pre-TCR during T cell development, Fc RIII on NK cells, and FceRI on mast cells. LAT is multiply phosphorylated on tyrosines by ZAP-70 and Syk, which leads to downstream effects that include release of intracellular calcium, PKC activation, MAPK activation and cytoskeletal reorganization. Palmitoylation of LAT is required for its localization to lipid rafts and efficient phosphorylation. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGPHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice