LASS6 (LAG1 Longevity Assurance Homolog 6, LAG1 Homolog Ceramide Synthase 6, CerS6, MGC129949, MGC129950)

Size

£685.00

SKU:: 129014
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa62-132 from human LASS6 (NP_982288) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5H7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: LASS6 may be involved in sphingolipid synthesis or its regulation (By similarity). Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody. Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml detected LASS6 using immunoperoxidase staining on formalin-fixed paraffin-embedded human colon. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEKPSTLTR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.