LANCL1 (LanC-like Protein 1, 40kD Erythrocyte Membrane Protein, p40, GPR69A)

Size

£685.00

SKU:: 128996
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1-58 from human LANCL1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 9A12
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: May play a role in EPS8 signaling. Binds glutathion. Applications: Suitable for use in Western Blot and ELISA. Other applications have not been tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.