128992-PE
LAMC1 (Laminin Subunit gamma-1, Laminin B2 Chain, Laminin-1 Subunit gamma, Laminin-10 Subunit gamma, Laminin-11 Subunit gamma, Laminin-2 Subunit gamma, Laminin-3 Subunit gamma, Laminin-4 Subunit gamma, Laminin-6 Subunit gamma, Laminin-7 Subunit gamma, Laminin-8 Subunit gamma, Laminin-9 Subunit gamma, S-laminin Subunit gamma, S-LAM gamma, Laminin B2, gamma1, LAMB2, MGC87297) (PE)
Size
£914.00
- SKU:
- 128992-PE
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-38 from human LAMC1 (AAH15586) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- M1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- Laminins are large heterotrimeric, non-collagenous glycoproteins composed of alpha, beta, and gamma chains. They are ubiquitously present in basement membrane (BM) along with entactin/nidogen (EN), collagen type IV (CIV), large heparan sulfate proteoglycan (HSPG), which interact specifically with each other to form a continuous and regular BM. Alterations of BM integrity, from local discontinuities up to complete loss, are described in many types of human and animal epithelial neoplasms. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice