Lactate Dehydrogenase (LD, LDHA, LDHB, LDH Heart Subunit, LDHH, LDH1, LDH Muscle Subunit, LDHM, NY-REN-46 Antigen, NY-REN-59 Antigen, Proliferation Inducing Gene 19 Protein, PIG19, TRG5) (Not for Export EU)

Size

£760.00

SKU:: 128982
Purity:: Serum
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human LDHA, aa1-332 (NP_005557.1).
Format:: Supplied as a liquid.
Extra Details:: Lactate dehydrogenase (LDH) contains two isoforms in mammals, LDH-M and LDH-H, which come together to form a homotetramer of 36kD subunits. LDH is often as a marker for tissue breakdown or cytotoxicity. LDH shows cytoplasm localization. Applications: Suitable for use in Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.