KRT71 (Keratin, Type II Cytoskeletal 71, Cytokeratin-71, CK-71, Keratin-71, K71, Type II Inner Root Sheath-specific Keratin-K6irs1, Keratin 6 Irs, hK6irs, hK6irs1, Type-II Keratin Kb34, K6IRS1, KB34, KRT6IRS1, MGC119390, MGC119391)

Size

£685.00

SKU:: 128959
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa251-333 from human KRT71 (NP_258259) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Plays a central role in hair formation. Essential component of keratin intermediate filaments in the inner root sheath (IRS) of the hair follicle. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LQAKVESMDQEIKFFRCLFEAEITQIQSHISDMSVILSMDNNRNLDLDSIIDEVRTQYEEIALKSKAEAEALYQTKFQELQL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.