KLRG1 (Killer Cell Lectin-like Receptor Subfamily G Member 1, 2F1-Ag, Mast Cell Function-associated Antigen 2F1, MAFA, MAFA-L, MGC123930) (Not for Export EU)

Size

£760.00

SKU:: 128904
Purity:: Serum.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full-length recombinant protein corresponding to aa1-189 of human KLRG1.
Format:: Supplied as a liquid.
Extra Details:: KLRG1 (killer cell lectin-like receptor G1), is the mouse homolog of the rat mast cell function-associated antigen (MAFA). It is expressed by activated CD8 T-cells and by a large proportion of natural killer (NK) cells. It is not found in the spleen, thymus, lymph nodes, testis, brain or kidney and is not expressed on mast cell lines, bone-marrow-derived mast cells or peritoneal mast cells. T-cells expressing KLRG1 have greatly reduced proliferation potential, but are not limited in their capacity to perform immediate effector cell functions, such as the secretion of gamma interferon. KLRG1 plays an inhibitory role on NK cells and T-cells by binding to their ligands. Applications: Suitable for use in Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKVRL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice