KLRC4 (NKG2F, NKG2-F Type II Integral Membrane Protein, NK Cell Receptor F, NKG2-F-activating NK Receptor, FLJ17759, FLJ78582)

Size

£685.00

SKU:: 128902
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-159 from KLRC4 (AAH17784) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: May play a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.