KLF5 (Kruppel-like Factor 5, Basic Transcription Element Binding Protein 2, BTE-binding Protein 2, BTEB2, Colon Krueppel-like Factor, CKLF, GC Box Binding Protein 2, Intestinal-enriched Krueppel-like Factor, IKLF, Transcription Factor BTEB2)

Size

£685.00

SKU:: 128855
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa358-457 from human KLF5 (NP_001721) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: KLF5 is a member of the Kruppel-like factor subfamily of zinc finger proteins. Since the protein localizes to the nucleus and binds the epidermal growth factor response element, the protein is thought to be a transcription factor. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.