KLF11 (Kruppel-like Factor 11, FKLF, FKLF1, MODY7, Transforming Growth Factor beta-Inducible Early Growth Response Protein 2, TGFb-Inducible Early Growth Response Protein 2, TIEG2, TIEG-2, Krueppel-like Factor 11, Tieg3)

Size

£685.00

SKU:: 128848
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa404-513 from KLF11 (NP_003588) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 8F4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: TIEG2 is a transcription factor. The protein activates the epsilon- and gamma-globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding inhibiting cell growth. It represses transcription of SMAD7 which enhances TGF-beta signaling. It induces apoptosis. Applications: Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.