128848-HRP
KLF11 (Kruppel-like Factor 11, FKLF, FKLF1, MODY7, Transforming Growth Factor beta-Inducible Early Growth Response Protein 2, TGFb-Inducible Early Growth Response Protein 2, TIEG2, TIEG-2, Krueppel-like Factor 11, Tieg3) (HRP)
Size
£914.00
- SKU:
- 128848-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa404-513 from KLF11 (NP_003588) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 8F4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- TIEG2 is a transcription factor. The protein activates the epsilon- and gamma-globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding inhibiting cell growth. It represses transcription of SMAD7 which enhances TGF-beta signaling. It induces apoptosis. Applications: Suitable for use in ELISA, Immunohistochemistry, and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice