128833
KIR2DL5 (Killer Cell Immunoglobulin-like Receptor 2DL5A, CD158f1, KIR2DL5A, CD158F, CD158F1)
Size
£760.00
- SKU:
- 128833
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human KIR2DL5A, aa1-375 (AAI60063.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- KIR2DL5 is the most recently identified human killer cell immunoglobulin-like receptors (KIR), which are transmembrane glycoproteins expressed by natural killer cells (NK) and subsets of T cells. KIR2DL5 is a type II member of the KIR2D family with two extracellular Ig-like domains of the D0 and D2 type. Its structure is expressed by 50% of humans and is conserved among primate species. Its gene localized on human chromosome 19p13.3, is restricted to the B subset of KIR haplotypes. The protein is represented in the human genome by two genes, KIR2DL5A and KIR2DL5B that show 99.5-99.7% identity in their coding sequences. The protein acts as a receptor on NK cells for HLA-C alleles, inhibits the activity of NK cell and thus plays a specialized role in innate immunity. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLHILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTALSQNRVASSHVPAAGI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice