KCNK10 (TREK2, Potassium Channel Subfamily K Member 10, Outward Rectifying Potassium Channel Protein TREK-2, TREK-2 K(+) Channel Subunit, FLJ43399, K2p10.1, TREK-2)

Size

£685.00

SKU:: 128750
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa439-539 from human KCNK10 (NP_066984) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1C1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K+ currents. Activated by arachidonic acid and other naturally occurring unsaturated free fatty acids. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLEDRN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.