128750-BIOTIN

KCNK10 (TREK2, Potassium Channel Subfamily K Member 10, Outward Rectifying Potassium Channel Protein TREK-2, TREK-2 K(+) Channel Subunit, FLJ43399, K2p10.1, TREK-2) (Biotin)

Size

£914.00

SKU:: 128750-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa439-539 from human KCNK10 (NP_066984) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1C1
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K+ currents. Activated by arachidonic acid and other naturally occurring unsaturated free fatty acids. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLEDRN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.