Kallikrein 5 (Kallikrein-5, KLK5, Kallikrein-like Protein 2, KLKL2, KLK-L2, Kallikrein-related Peptidase 5, Stratum Corneum Tryptic Enzyme, SCTE, UNQ570/PRO1132)

Size

£685.00

SKU:: 128714
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa194-293 from human Kallikrein 5 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3H3
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Kallikreins are a subgroup of serine proteases and are implicated in carcinogenesis. A novel KLK gene, KLK12, is expressed in a variety of tissues including salivary gland, stomach, uterus, lung, thymus, prostate, colon, brain, breast, thyroid, and trachea. It has applications as a novel cancer biomarker. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: KSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.