128714-BIOTIN
Kallikrein 5 (Kallikrein-5, KLK5, Kallikrein-like Protein 2, KLKL2, KLK-L2, Kallikrein-related Peptidase 5, Stratum Corneum Tryptic Enzyme, SCTE, UNQ570/PRO1132) (Biotin)
Size
£914.00
- SKU:
- 128714-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa194-293 from human Kallikrein 5 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3H3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Kallikreins are a subgroup of serine proteases and are implicated in carcinogenesis. A novel KLK gene, KLK12, is expressed in a variety of tissues including salivary gland, stomach, uterus, lung, thymus, prostate, colon, brain, breast, thyroid, and trachea. It has applications as a novel cancer biomarker. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: KSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice